Lineage for d1mhta_ (1mht A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893725Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2893730Protein DNA methylase HhaI [53367] (2 species)
  7. 2893731Species Haemophilus haemolyticus [TaxId:726] [53368] (16 PDB entries)
    Uniprot P05102
  8. 2893747Domain d1mhta_: 1mht A: [34236]
    protein/DNA complex; complexed with sah

Details for d1mhta_

PDB Entry: 1mht (more details), 2.6 Å

PDB Description: covalent ternary structure of hhai methyltransferase, dna and s- adenosyl-l-homocysteine
PDB Compounds: (A:) protein (hhai methyltransferase)

SCOPe Domain Sequences for d1mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOPe Domain Coordinates for d1mhta_:

Click to download the PDB-style file with coordinates for d1mhta_.
(The format of our PDB-style files is described here.)

Timeline for d1mhta_: