Lineage for d1mhta_ (1mht A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 72963Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 72964Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (13 families) (S)
  5. 73045Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 73050Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 73051Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 73059Domain d1mhta_: 1mht A: [34236]

Details for d1mhta_

PDB Entry: 1mht (more details), 2.8 Å

PDB Description: covalent ternary structure of hhai methyltransferase, dna and s- adenosyl-l-homocysteine

SCOP Domain Sequences for d1mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d1mhta_:

Click to download the PDB-style file with coordinates for d1mhta_.
(The format of our PDB-style files is described here.)

Timeline for d1mhta_: