SCOP 1.73: Domain d2hmyb_: 2hmy B:

Lineage for d2hmyb_ (2hmy B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families)

5. Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)

6. Protein DNA methylase HhaI [53367] (1 species)

7. Species Haemophilus haemolyticus [TaxId:726] [53368] (20 PDB entries)

8. Domain d2hmyb_: 2hmy B: [34235]
   complexed with sam

Details for d2hmyb_

PDB Entry: 2hmy, 2.61 Å

PDB Description: binary complex of hhai methyltransferase with adomet formed in the presence of a short nonpsecific dna oligonucleotide

PDB Compounds: (B:) protein (cytosine-specific methyltransferase hhai)

SCOP Domain Sequences for d2hmyb_:

Sequence; same for both SEQRES and ATOM records:

>d2hmyb_ c.66.1.26 (B:) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

Timeline for d2hmyb_:

• d2hmyb_ first appeared (with stable ids) in SCOP 1.55
  
• d2hmyb_ appears in SCOP 1.71
  
• d2hmyb_ appears in SCOP 1.75
  
• d2hmyb_ appears in the current release, SCOPe 2.08