Lineage for d2hmyb_ (2hmy B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26076Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 26077Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) (S)
  5. 26156Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 26161Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 26162Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 26171Domain d2hmyb_: 2hmy B: [34235]

Details for d2hmyb_

PDB Entry: 2hmy (more details), 2.61 Å

PDB Description: binary complex of hhai methyltransferase with adomet formed in the presence of a short nonpsecific dna oligonucleotide

SCOP Domain Sequences for d2hmyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmyb_ c.66.1.10 (B:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d2hmyb_:

Click to download the PDB-style file with coordinates for d2hmyb_.
(The format of our PDB-style files is described here.)

Timeline for d2hmyb_: