Lineage for d5a15k_ (5a15 K:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2552337Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2552338Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2552678Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2552679Protein automated matches [190710] (5 species)
    not a true protein
  7. 2552682Species Human (Homo sapiens) [TaxId:9606] [187857] (53 PDB entries)
  8. 2552801Domain d5a15k_: 5a15 K: [342327]
    automated match to d3drzc_

Details for d5a15k_

PDB Entry: 5a15 (more details), 2.76 Å

PDB Description: crystal structure of the btb domain of human kctd16
PDB Compounds: (K:) btb/poz domain-containing protein kctd16

SCOPe Domain Sequences for d5a15k_:

Sequence, based on SEQRES records: (download)

>d5a15k_ d.42.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpevvelnvggqvyftrhstlisiphsllwkmfspkrdtandlakdskgrffidrdgflf
ryildylrdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp

Sequence, based on observed residues (ATOM records): (download)

>d5a15k_ d.42.1.0 (K:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fpevvelnvggqvyftrhstlisiphsllwkmfsplakdskgrffidrdgflfryildyl
rdrqvvlpdhfpekgrlkreaeyfqlpdlvklltp

SCOPe Domain Coordinates for d5a15k_:

Click to download the PDB-style file with coordinates for d5a15k_.
(The format of our PDB-style files is described here.)

Timeline for d5a15k_: