Lineage for d10mha_ (10mh A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399355Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 399356Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (38 families) (S)
  5. 399649Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 399654Protein DNA methylase HhaI [53367] (1 species)
  7. 399655Species Haemophilus haemolyticus [TaxId:726] [53368] (13 PDB entries)
  8. 399662Domain d10mha_: 10mh A: [34232]
    protein/DNA complex; complexed with 5mc, 5nc, sah

Details for d10mha_

PDB Entry: 10mh (more details), 2.55 Å

PDB Description: ternary structure of hhai methyltransferase with adohcy and hemimethylated dna containing 5,6-dihydro-5-azacytosine at the target

SCOP Domain Sequences for d10mha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d10mha_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d10mha_:

Click to download the PDB-style file with coordinates for d10mha_.
(The format of our PDB-style files is described here.)

Timeline for d10mha_: