Lineage for d7mhta_ (7mht A:)
- Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (20 families) 
Family c.66.1.10: DNA methylases [53366] (5 proteins) 
Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species) Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries) 
Domain d7mhta_: 7mht A: [34231]
Details for d7mhta_
PDB Entry: 7mht (more details), 2.87 Å
PDB Description: cytosine-specific methyltransferase hhai/dna complex
SCOP Domain Sequences for d7mhta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy
SCOP Domain Coordinates for d7mhta_:
Click to download the PDB-style file with coordinates for d7mhta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7mhta_:
- d7mhta_ first appeared (with stable ids) in SCOP 1.55
- d7mhta_ appears in SCOP 1.59
- d7mhta_ appears in SCOP 1.63
- d7mhta_ appears in the current release, SCOPe 2.08
View in 3D