Lineage for d7mhta_ (7mht A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183417Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
  4. 183418Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (20 families) (S)
  5. 183515Family c.66.1.10: DNA methylases [53366] (5 proteins)
  6. 183520Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species)
  7. 183521Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries)
  8. 183528Domain d7mhta_: 7mht A: [34231]

Details for d7mhta_

PDB Entry: 7mht (more details), 2.87 Å

PDB Description: cytosine-specific methyltransferase hhai/dna complex

SCOP Domain Sequences for d7mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d7mhta_:

Click to download the PDB-style file with coordinates for d7mhta_.
(The format of our PDB-style files is described here.)

Timeline for d7mhta_: