Lineage for d6mhta_ (6mht A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 490261Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 490262Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (39 families) (S)
  5. 490585Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (3 proteins)
  6. 490590Protein DNA methylase HhaI [53367] (1 species)
  7. 490591Species Haemophilus haemolyticus [TaxId:726] [53368] (15 PDB entries)
  8. 490592Domain d6mhta_: 6mht A: [34226]

Details for d6mhta_

PDB Entry: 6mht (more details), 2.05 Å

PDB Description: ternary structure of hhai methyltransferase with adohcy and dna containing 4'-thio-2'deoxycytidine at the target

SCOP Domain Sequences for d6mhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mhta_ c.66.1.26 (A:) DNA methylase HhaI {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

SCOP Domain Coordinates for d6mhta_:

Click to download the PDB-style file with coordinates for d6mhta_.
(The format of our PDB-style files is described here.)

Timeline for d6mhta_: