Lineage for d6mhta_ (6mht A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (11 families) 
Family c.66.1.10: DNA methylases [53366] (5 proteins) 
Protein DNA methylase HhaI, coenzyme-binding domain [53367] (1 species) Species Haemophilus haemolyticus [TaxId:726] [53368] (12 PDB entries) 
Domain d6mhta_: 6mht A: [34226]
Details for d6mhta_
PDB Entry: 6mht (more details), 2.05 Å
PDB Description: ternary structure of hhai methyltransferase with adohcy and dna containing 4'-thio-2'deoxycytidine at the target
SCOP Domain Sequences for d6mhta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mhta_ c.66.1.10 (A:) DNA methylase HhaI, coenzyme-binding domain {Haemophilus haemolyticus}
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy
SCOP Domain Coordinates for d6mhta_:
Click to download the PDB-style file with coordinates for d6mhta_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d6mhta_:
- d6mhta_ appears in SCOP 1.57
- d6mhta_ appears in the current release, SCOPe 2.08
View in 3D