Lineage for d1g6q6_ (1g6q 6:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892965Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins)
    lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain
  6. 2892966Protein Arginine methyltransferase, HMT1 [53352] (2 species)
  7. 2892967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53353] (1 PDB entry)
  8. 2892973Domain d1g6q6_: 1g6q 6: [34200]

Details for d1g6q6_

PDB Entry: 1g6q (more details), 2.9 Å

PDB Description: crystal structure of yeast arginine methyltransferase, hmt1
PDB Compounds: (6:) hnrnp arginine n-methyltransferase

SCOPe Domain Sequences for d1g6q6_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6q6_ c.66.1.6 (6:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hygiheemlqdtvrtlsyrnaiiqnkdlfkdkivldvgcgtgilsmfaakhgakhvigvd
mssiiemakelvelngfsdkitllrgkledvhlpfpkvdiiisewmgyfllyesmmdtvl
yardhylvegglifpdkcsihlagledsqykdeklnywqdvygfdyspfvplvlhepivd
tvernnvnttsdkliefdlntvkisdlafksnfkltakrqdmingivtwfdivfpapkgk
rpvefstgphapythwkqtifyfpddldaetgdtiegelvcspneknnrdlnikisykfe
sngidgnsrsrknegsylmh

SCOPe Domain Coordinates for d1g6q6_:

Click to download the PDB-style file with coordinates for d1g6q6_.
(The format of our PDB-style files is described here.)

Timeline for d1g6q6_: