Lineage for d5yrra_ (5yrr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119569Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2119570Protein automated matches [190459] (50 species)
    not a true protein
  7. 2119573Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries)
  8. 2119586Domain d5yrra_: 5yrr A: [341965]
    automated match to d3f3ma_
    complexed with coa, so4

Details for d5yrra_

PDB Entry: 5yrr (more details), 2.88 Å

PDB Description: the crystal structure of phosphopantetheine adenylyltransferase from acinetobacter baumannii with coenzyme a at 2.88 a resolution
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5yrra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5yrra_ c.26.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

SCOPe Domain Coordinates for d5yrra_:

Click to download the PDB-style file with coordinates for d5yrra_.
(The format of our PDB-style files is described here.)

Timeline for d5yrra_: