SCOPe 2.04: Domain d1d2ha_: 1d2h A:

Lineage for d1d2ha_ (1d2h A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein)

6. Protein Glycine N-methyltransferase [53349] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries)

8. Domain d1d2ha_: 1d2h A: [34191]
   complexed with sah; mutant

Details for d1d2ha_

PDB Entry: 1d2h, 3 Å

PDB Description: crystal structure of r175k mutant glycine n-methyltransferase complexed with s-adenosylhomocysteine

PDB Compounds: (A:) glycine n-methyltransferase

SCOPe Domain Sequences for d1d2ha_:

Sequence; same for both SEQRES and ATOM records:

>d1d2ha_ c.66.1.5 (A:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
taeykawllgllrqhgchrvldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwn
rrkepafdkwvieeanwltldkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkni
asmvrpggllvidhknydyilstgcappgkniyyksdltkdittsvltvnnkahmvtldy
tvqvpgagrdgapgfskfrlsyyphclasftelvqeafggrcqhsvlgdfkpyrpgqayv
pcyfihvlkktg

Timeline for d1d2ha_:

• d1d2ha_ first appeared (with stable ids) in SCOP 1.55
  
• d1d2ha_ appears in SCOPe 2.03
  
• d1d2ha_ appears in SCOPe 2.05
  
• d1d2ha_ appears in the current release, SCOPe 2.08