Lineage for d1d2ca_ (1d2c A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.5: Glycine N-methyltransferase [53348] (1 protein) Protein Glycine N-methyltransferase [53349] (3 species) Species Norway rat (Rattus norvegicus) [TaxId:10116] [53350] (12 PDB entries) 
Domain d1d2ca_: 1d2c A: [34185]
Details for d1d2ca_
PDB Entry: 1d2c (more details), 2.5 Å
PDB Description: methyltransferase
PDB Compounds: (A:) protein (glycine n-methyltransferase)SCOPe Domain Sequences for d1d2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2ca_ c.66.1.5 (A:) Glycine N-methyltransferase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtaeykawllgllrqhgchrv
ldvacgtgvdsimlveegfsvtsvdasdkmlkyalkerwnrrkepafdkwvieeanwltl
dkdvpagdgfdaviclgnsfahlpdskgdqsehrlalkniasmvrpggllvidhrnydyi
lstgcappgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrl
syyphclasftelvqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg
SCOPe Domain Coordinates for d1d2ca_:
Click to download the PDB-style file with coordinates for d1d2ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1d2ca_:
- d1d2ca_ first appeared (with stable ids) in SCOP 1.55
- d1d2ca_ appears in SCOPe 2.07
View in 3D
