Lineage for d5nl9b1 (5nl9 B:1-145)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984396Species Leptospira interrogans [TaxId:267671] [341818] (1 PDB entry)
  8. 1984398Domain d5nl9b1: 5nl9 B:1-145 [341821]
    Other proteins in same PDB: d5nl9a2, d5nl9b2
    automated match to d4rb3c_
    complexed with k, unx, zn

Details for d5nl9b1

PDB Entry: 5nl9 (more details), 1.9 Å

PDB Description: crystal structure of a peroxide stress regulator from leptospira interrogans
PDB Compounds: (B:) Transcriptional regulator (FUR family)

SCOPe Domain Sequences for d5nl9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nl9b1 a.4.5.0 (B:1-145) automated matches {Leptospira interrogans [TaxId: 267671]}
mkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnasratifn
nlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekvlselkq
dfklktgsslencnlsitlkgkknp

SCOPe Domain Coordinates for d5nl9b1:

Click to download the PDB-style file with coordinates for d5nl9b1.
(The format of our PDB-style files is described here.)

Timeline for d5nl9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5nl9b2