Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Leptospira interrogans [TaxId:267671] [341818] (1 PDB entry) |
Domain d5nl9b1: 5nl9 B:1-145 [341821] Other proteins in same PDB: d5nl9a2, d5nl9b2 automated match to d4rb3c_ complexed with k, unx, zn |
PDB Entry: 5nl9 (more details), 1.9 Å
SCOPe Domain Sequences for d5nl9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nl9b1 a.4.5.0 (B:1-145) automated matches {Leptospira interrogans [TaxId: 267671]} mkdsyerskkiledaginvtvqrlqmanlllskpqhltadqvfqlinehmpnasratifn nlklfaekgivnllelksgitlydsnvihhhhaidektgeiydisldsklqekvlselkq dfklktgsslencnlsitlkgkknp
Timeline for d5nl9b1: