Lineage for d5orfd2 (5orf D:196-387)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013466Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2013467Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2013840Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2013841Protein automated matches [254493] (6 species)
    not a true protein
  7. 2014007Species Sheep (Ovis aries) [TaxId:9940] [259659] (3 PDB entries)
  8. 2014024Domain d5orfd2: 5orf D:196-387 [341735]
    automated match to d3uiva1
    complexed with peg, pge, pro

Details for d5orfd2

PDB Entry: 5orf (more details), 2.54 Å

PDB Description: structure of ovine serum albumin in p1 space group
PDB Compounds: (D:) serum albumin

SCOPe Domain Sequences for d5orfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5orfd2 a.126.1.0 (D:196-387) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
rlrcasiqkfgeralkawsvarlsqkfpkadftdvtkivtdltkvhkecchgdllecadd
radlakyicdhqdalssklkeccdkpvlekshciaevdkdavpenlppltadfaedkevc
knyqeakdvflgsflyeysrrhpeyavsvllrlakeyeatledccakedphacyatvfdk
lkhlvdepqnli

SCOPe Domain Coordinates for d5orfd2:

Click to download the PDB-style file with coordinates for d5orfd2.
(The format of our PDB-style files is described here.)

Timeline for d5orfd2: