SCOPe 2.07: Domain d5mjmb_: 5mjm B:

Lineage for d5mjmb_ (5mjm B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein Phycocyanin beta subunit [88940] (9 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [189583] (11 PDB entries)

8. Domain d5mjmb_: 5mjm B: [341515]
   Other proteins in same PDB: d5mjma_
   automated match to d1ktpb_
   complexed with cyc

Details for d5mjmb_

PDB Entry: 5mjm, 2.3 Å

PDB Description: single-shot pink beam serial crystallography: phycocyanin (five chips merged)

PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d5mjmb_:

Sequence; same for both SEQRES and ATOM records:

>d5mjmb_ a.1.1.3 (B:) Phycocyanin beta subunit {Thermosynechococcus elongatus [TaxId: 197221]}
mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava

Timeline for d5mjmb_:

• d5mjmb_ first appeared in SCOPe 2.06
  
• d5mjmb_ appears in the current release, SCOPe 2.08