Lineage for d1qc5b_ (1qc5 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144673Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2144674Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2144675Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 2144714Protein Integrin alpha1-beta1 [53310] (2 species)
  7. 2144715Species Human (Homo sapiens) [TaxId:9606] [53311] (4 PDB entries)
  8. 2144721Domain d1qc5b_: 1qc5 B: [34148]
    complexed with mg

Details for d1qc5b_

PDB Entry: 1qc5 (more details), 2 Å

PDB Description: i domain from integrin alpha1-beta1
PDB Compounds: (B:) protein (alpha1 beta1 integrin)

SCOPe Domain Sequences for d1qc5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qc5b_ c.62.1.1 (B:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdeialv
tivktlgeri

SCOPe Domain Coordinates for d1qc5b_:

Click to download the PDB-style file with coordinates for d1qc5b_.
(The format of our PDB-style files is described here.)

Timeline for d1qc5b_: