Lineage for d1zopa_ (1zop A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1611341Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1611342Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1611343Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)
  6. 1611410Protein Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) [53302] (1 species)
  7. 1611411Species Human (Homo sapiens) [TaxId:9606] [53303] (26 PDB entries)
    Uniprot P20701 153-334
  8. 1611430Domain d1zopa_: 1zop A: [34124]
    complexed with cl, mn

Details for d1zopa_

PDB Entry: 1zop (more details), 2 Å

PDB Description: cd11a i-domain with bound magnesium ion
PDB Compounds: (A:) I-domain fragment of lfa-1

SCOPe Domain Sequences for d1zopa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zopa_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}
gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
vie

SCOPe Domain Coordinates for d1zopa_:

Click to download the PDB-style file with coordinates for d1zopa_.
(The format of our PDB-style files is described here.)

Timeline for d1zopa_: