Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
Family c.23.16.0: automated matches [191336] (1 protein) not a true family |
Protein automated matches [190197] (24 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries) |
Domain d5xr3c1: 5xr3 C:6-292 [341092] Other proteins in same PDB: d5xr3a2, d5xr3c2, d5xr3g2 automated match to d1izya_ complexed with glv |
PDB Entry: 5xr3 (more details), 3.01 Å
SCOPe Domain Sequences for d5xr3c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xr3c1 c.23.16.0 (C:6-292) automated matches {Staphylococcus aureus [TaxId: 158878]} nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf ivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk
Timeline for d5xr3c1: