Lineage for d5xr3c1 (5xr3 C:6-292)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2467009Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2467511Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2467512Protein automated matches [190197] (24 species)
    not a true protein
  7. 2467714Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. 2467735Domain d5xr3c1: 5xr3 C:6-292 [341092]
    Other proteins in same PDB: d5xr3a2, d5xr3c2, d5xr3g2
    automated match to d1izya_
    complexed with glv

Details for d5xr3c1

PDB Entry: 5xr3 (more details), 3.01 Å

PDB Description: sav0551 with glyoxylate
PDB Compounds: (C:) Protein/nucleic acid deglycase HchA

SCOPe Domain Sequences for d5xr3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xr3c1 c.23.16.0 (C:6-292) automated matches {Staphylococcus aureus [TaxId: 158878]}
nelskqptpdkaednaffpspyslsqytapktdfdgvehkgaykdgkwkvlmiaaeeryv
llengkmfstgnhpvemllplhhlmeagfdvdvatlsgypvklelwamptedeavistyn
klkeklkqpkkladviknelgpdsdylsvfipgghaavvgisesedvqqtldwaldndrf
ivtlxhgpaallsaglnreksplegysvcvfpdsldeganieigylpgrlkwlvadlltk
qglkvvnddmtgrtlkdrklltgdsplasnelgklavnemlnaiqnk

SCOPe Domain Coordinates for d5xr3c1:

Click to download the PDB-style file with coordinates for d5xr3c1.
(The format of our PDB-style files is described here.)

Timeline for d5xr3c1: