SCOPe 2.07: Domain d5vt2a_: 5vt2 A:

Lineage for d5vt2a_ (5vt2 A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.0: automated matches [191392] (1 protein)
   not a true family

6. Protein automated matches [190506] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187459] (38 PDB entries)

8. Domain d5vt2a_: 5vt2 A: [341056]
   automated match to d2qcqb_
   complexed with edo

Details for d5vt2a_

PDB Entry: 5vt2, 2.3 Å

PDB Description: crystal structure of growth differentiation factor

PDB Compounds: (A:) Growth/differentiation factor 15

SCOPe Domain Sequences for d5vt2a_:

Sequence; same for both SEQRES and ATOM records:

>d5vt2a_ g.17.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhcplgpgrccrlhtvrasledlgwadwvlsprevqvtmcigacpsqfraanmhaqikts
lhrlkpdtvpapccvpasynpmvliqktdtgvslqtyddllakdchci

Timeline for d5vt2a_:

• d5vt2a_ first appeared in SCOPe 2.06
  
• d5vt2a_ appears in the current release, SCOPe 2.08