SCOPe 2.07: Domain d1opra_: 1opr A:

Lineage for d1opra_ (1opr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Orotate PRTase [53290] (3 species)

7. Species Salmonella typhimurium [TaxId:90371] [53291] (3 PDB entries)

8. Domain d1opra_: 1opr A: [34091]
   complexed with mg, oro, prp

Details for d1opra_

PDB Entry: 1opr, 2.3 Å

PDB Description: the crystal structure of the orotate phosphoribosyltransferase complexed with orotate and alpha-d-5-phosphoribosyl-1-pyrophosphate

PDB Compounds: (A:) orotate phosphoribosyltransferase

SCOPe Domain Sequences for d1opra_:

Sequence; same for both SEQRES and ATOM records:

>d1opra_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]}
mkpyqrqfiefalnkqvlkfgeftlksgrkspyffnaglfntgrdlallgrfyaealvds
giefdllfgpaykgipiatttavalaehhdkdlpycfnrkeakdhgeggslvgsalqgrv
mlvddvitagtairesmeiiqahgatlagvlisldrqergrgeisaiqeverdygckvis
iitlkdliayleekpdmaehlaavrayreefgv

Timeline for d1opra_:

• d1opra_ first appeared (with stable ids) in SCOP 1.55, called d1opr__
  
• d1opra_ appears in SCOPe 2.06
  
• d1opra_ appears in the current release, SCOPe 2.08