SCOPe 2.07: Domain d5n30a1: 5n30 A:59-162

Lineage for d5n30a1 (5n30 A:59-162)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (3 families)

5. Family b.1.6.2: Dystroglycan, N-terminal domain [110062] (2 proteins)

6. Protein automated matches [272731] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [272732] (3 PDB entries)

8. Domain d5n30a1: 5n30 A:59-162 [340896]
   Other proteins in same PDB: d5n30a2
   automated match to d4wiqa1
   complexed with edo, peg; mutant

Details for d5n30a1

PDB Entry: 5n30, 1.8 Å

PDB Description: crystal structure of the v72i mutant of the mouse alpha-dystroglycan n-terminal region

PDB Compounds: (A:) Dystroglycan

SCOPe Domain Sequences for d5n30a1:

Sequence; same for both SEQRES and ATOM records:

>d5n30a1 b.1.6.2 (A:59-162) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vptvvgipdgtavigrsfrvsiptdliassgeiikvsaagkealpswlhwdphshilegl
pldtdkgvhyisvsaarlgangshvpqtssvfsievypedhnep

Timeline for d5n30a1:

• d5n30a1 first appeared in SCOPe 2.06
  
• d5n30a1 appears in the current release, SCOPe 2.08