Lineage for d3l4ib1 (3l4i B:19-205)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2491250Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2492670Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2492671Protein automated matches [226839] (63 species)
    not a true protein
  7. 2492803Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries)
  8. 2492806Domain d3l4ib1: 3l4i B:19-205 [340886]
    automated match to d5fpea1
    complexed with adp, cl, edo, po4

Details for d3l4ib1

PDB Entry: 3l4i (more details), 2.2 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 (cgd2_20) from cryptosporidium parvum in complex with adp and inorganic phosphate
PDB Compounds: (B:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l4ib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4ib1 c.55.1.0 (B:19-205) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarnp
entvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisam
vlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaaia
ygldkkg

SCOPe Domain Coordinates for d3l4ib1:

Click to download the PDB-style file with coordinates for d3l4ib1.
(The format of our PDB-style files is described here.)

Timeline for d3l4ib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l4ib2