SCOPe 2.07: Domain d3l4ib1: 3l4i B:19-205

Lineage for d3l4ib1 (3l4i B:19-205)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (63 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [225813] (2 PDB entries)

8. Domain d3l4ib1: 3l4i B:19-205 [340886]
   automated match to d5fpea1
   complexed with adp, cl, edo, po4

Details for d3l4ib1

PDB Entry: 3l4i, 2.2 Å

PDB Description: crystal structure of the n-terminal domain of hsp70 (cgd2_20) from cryptosporidium parvum in complex with adp and inorganic phosphate

PDB Compounds: (B:) Heat shock 70 (HSP70) protein

SCOPe Domain Sequences for d3l4ib1:

Sequence; same for both SEQRES and ATOM records:

>d3l4ib1 c.55.1.0 (B:19-205) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gpaigidlgttyscvgvwrndtvdivpndqgnrttpsyvafteterligdaaknqvarnp
entvfdakrligrkfddqavqsdmthwpfkvvrgpkdkpiisvnylgekkefhaeeisam
vlqkmkeiseaylgrqiknavvtvpayfndsqrqatkdagaiaglnvmriineptaaaia
ygldkkg

Timeline for d3l4ib1:

• d3l4ib1 first appeared in SCOPe 2.06
  
• d3l4ib1 appears in the current release, SCOPe 2.08