Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.131: DNA clamp [55978] (1 superfamily) contains two helices and two beta sheets duplication: fold has internal pseudo two-fold symmetry |
Superfamily d.131.1: DNA clamp [55979] (3 families) |
Family d.131.1.0: automated matches [227185] (1 protein) not a true family |
Protein automated matches [226907] (20 species) not a true protein |
Species Enterobacter cloacae [TaxId:1045856] [340820] (1 PDB entry) |
Domain d6amqb1: 6amq B:1-122 [340840] automated match to d1ok7a1 complexed with so4 |
PDB Entry: 6amq (more details), 2.67 Å
SCOPe Domain Sequences for d6amqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6amqb1 d.131.1.0 (B:1-122) automated matches {Enterobacter cloacae [TaxId: 1045856]} mkftverehllkplqqvsgplggrptlpilgnlllqvadgtlsltgtdlememiarvtls qpheagattvparkffdicrglpegaeiavqlegdrmlvrsgrsrfslstlpaadfpnld dw
Timeline for d6amqb1: