SCOPe 2.05: Domain d1cjbd_: 1cjb D:

Lineage for d1cjbd_ (1cjb D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [53285] (1 PDB entry)

8. Domain d1cjbd_: 1cjb D: [34082]
   complexed with irp, mg, pop

Details for d1cjbd_

PDB Entry: 1cjb, 2 Å

PDB Description: malarial purine phosphoribosyltransferase

PDB Compounds: (D:) protein (hypoxanthine-guanine phosphoribosyltransferase)

SCOPe Domain Sequences for d1cjbd_:

Sequence; same for both SEQRES and ATOM records:

>d1cjbd_ c.61.1.1 (D:) Hypoxanthine-guanine PRTase (HGPRTase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

Timeline for d1cjbd_:

• d1cjbd_ first appeared (with stable ids) in SCOP 1.55
  
• d1cjbd_ appears in SCOPe 2.04
  
• d1cjbd_ appears in SCOPe 2.06
  
• d1cjbd_ appears in the current release, SCOPe 2.08