Lineage for d1cjbd_ (1cjb D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891453Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2891526Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [53285] (1 PDB entry)
  8. 2891530Domain d1cjbd_: 1cjb D: [34082]
    complexed with irp, mg, pop

Details for d1cjbd_

PDB Entry: 1cjb (more details), 2 Å

PDB Description: malarial purine phosphoribosyltransferase
PDB Compounds: (D:) protein (hypoxanthine-guanine phosphoribosyltransferase)

SCOPe Domain Sequences for d1cjbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cjbd_ c.61.1.1 (D:) Hypoxanthine-guanine PRTase (HGPRTase) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
pipnnpgagenafdpvfvndddgydldsfmipahykkyltkvlvpngviknrieklaydi
kkvynneefhilcllkgsrgfftallkhlsrihnysavetskplfgehyvrvksycndqs
tgtleivsedlsclkgkhvlivediidtgktlvkfceylkkfeiktvaiaclfikrtplw
ngfkadfvgfsipdhfvvgysldyneifrdldhcclvndegkkkykat

SCOPe Domain Coordinates for d1cjbd_:

Click to download the PDB-style file with coordinates for d1cjbd_.
(The format of our PDB-style files is described here.)

Timeline for d1cjbd_: