Lineage for d1hmpa_ (1hmp A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499121Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2499269Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2499270Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)
  8. 2499307Domain d1hmpa_: 1hmp A: [34075]
    complexed with 5gp

Details for d1hmpa_

PDB Entry: 1hmp (more details), 2.5 Å

PDB Description: the crystal structure of human hypoxanthine-guanine phosphoribosyltransferase with bound gmp
PDB Compounds: (A:) hypoxanthine guanine phosphoribosyl-transferase

SCOPe Domain Sequences for d1hmpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hmpa_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

SCOPe Domain Coordinates for d1hmpa_:

Click to download the PDB-style file with coordinates for d1hmpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hmpa_: