SCOP 1.75: Domain d1dqnb_: 1dqn B:

Lineage for d1dqnb_ (1dqn B:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (15 proteins)

6. Protein Guanine PRTase [53281] (1 species)

7. Species Giardia lamblia [TaxId:5741] [53282] (2 PDB entries)

8. Domain d1dqnb_: 1dqn B: [34068]
   complexed with imu, ipa, mg, pop

Details for d1dqnb_

PDB Entry: 1dqn, 1.75 Å

PDB Description: crystal structure of giardia guanine phosphoribosyltransferase complexed with a transition state analogue

PDB Compounds: (B:) guanine phosphoribosyltransferase

SCOP Domain Sequences for d1dqnb_:

Sequence; same for both SEQRES and ATOM records:

>d1dqnb_ c.61.1.1 (B:) Guanine PRTase {Giardia lamblia [TaxId: 5741]}
micsvtgkpvkdvlstffkdrndvlesevkkfhllatfeeckalaadtarrmneyykdva
epvtlvalltgaylyaslltvhltfpytlhfvkvssykgtrqesvvfdeedlkqlkekre
vvlideyvdsghtifsiqeqikhakicscfvkdvdaikkhsaladtkmfygytpmpkgsw
ligfglddnglrrgwahlfdinlsesevtefrrrltehikglningvnry

Timeline for d1dqnb_:

• d1dqnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dqnb_ appears in SCOP 1.73
  
• d1dqnb_ appears in SCOPe 2.01
  
• d1dqnb_ appears in the current release, SCOPe 2.08