Lineage for d1ecgb1 (1ecg B:250-500)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125303Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 125304Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 125305Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 125316Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 125326Species Escherichia coli [TaxId:562] [53280] (5 PDB entries)
  8. 125330Domain d1ecgb1: 1ecg B:250-500 [34056]
    Other proteins in same PDB: d1ecga2, d1ecgb2

Details for d1ecgb1

PDB Entry: 1ecg (more details), 2.3 Å

PDB Description: don inactivated escherichia coli glutamine phosphoribosylpyrophosphate (prpp) amidotransferase

SCOP Domain Sequences for d1ecgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ecgb1 c.61.1.1 (B:250-500) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli}
npclfeyvyfarpdsfidkisvysarvnmgtklgekiarewedldidvvipipetscdia
leiarilgkpyrqgfvknryvgrtfimpgqqlrrksvrrklnanraefrdknvllvddsi
vrgttseqiiemareagakkvylasaapeirfpnvygidmpsateliahgrevdeirqii
gadglifqdlndlidavraenpdiqqfecsvfngvyvtkdvdqgyldfldtlrnddakav
qrqnevenlem

SCOP Domain Coordinates for d1ecgb1:

Click to download the PDB-style file with coordinates for d1ecgb1.
(The format of our PDB-style files is described here.)

Timeline for d1ecgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ecgb2