SCOPe 2.08: Domain d1gph11: 1gph 1:235-465

Lineage for d1gph11 (1gph 1:235-465)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [53279] (2 PDB entries)

8. Domain d1gph11: 1gph 1:235-465 [34045]
   Other proteins in same PDB: d1gph12, d1gph22, d1gph32, d1gph42
   complexed with amp, sf4

Details for d1gph11

PDB Entry: 1gph, 3 Å

PDB Description: structure of the allosteric regulatory enzyme of purine biosynthesis

PDB Compounds: (1:) glutamine phosphoribosyl-pyrophosphate amidotransferase

SCOPe Domain Sequences for d1gph11:

Sequence; same for both SEQRES and ATOM records:

>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
icsmeyiyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaea
tgipyelgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgtts
rrivtmlreagatevhvkissppiahpcfygidtstheeliasshsvdeirqeigadtls
flsvegllkgigrkyddsncgqclacftgkypteiyqdtvlphvkeavltk

Timeline for d1gph11:

• d1gph11 first appeared (with stable ids) in SCOP 1.55
  
• d1gph11 appears in SCOPe 2.07