Lineage for d1gph41 (1gph 4:235-465)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2128255Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2128256Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2128257Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 protein domains)
  6. 2128284Protein Glutamine PRPP amidotransferase, C-terminal domain [53278] (2 species)
  7. 2128285Species Bacillus subtilis [TaxId:1423] [53279] (2 PDB entries)
  8. 2128293Domain d1gph41: 1gph 4:235-465 [34048]
    Other proteins in same PDB: d1gph12, d1gph22, d1gph32, d1gph42
    complexed with amp, sf4

Details for d1gph41

PDB Entry: 1gph (more details), 3 Å

PDB Description: structure of the allosteric regulatory enzyme of purine biosynthesis
PDB Compounds: (4:) glutamine phosphoribosyl-pyrophosphate amidotransferase

SCOPe Domain Sequences for d1gph41:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gph41 c.61.1.1 (4:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
icsmeyiyfsrpdsnidginvhsarknlgkmlaqesaveadvvtgvpdssisaaigyaea
tgipyelgliknryvgrtfiqpsqalreqgvrmklsavrgvvegkrvvmvddsivrgtts
rrivtmlreagatevhvkissppiahpcfygidtstheeliasshsvdeirqeigadtls
flsvegllkgigrkyddsncgqclacftgkypteiyqdtvlphvkeavltk

SCOPe Domain Coordinates for d1gph41:

Click to download the PDB-style file with coordinates for d1gph41.
(The format of our PDB-style files is described here.)

Timeline for d1gph41: