Lineage for d6bb9a1 (6bb9 A:1-269)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2248742Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
    2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8
  4. 2248743Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families) (S)
  5. 2248744Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)
  6. 2248829Protein automated matches [190187] (2 species)
    not a true protein
  7. 2248859Species Salmonella typhimurium [TaxId:90371] [340391] (1 PDB entry)
  8. 2248860Domain d6bb9a1: 6bb9 A:1-269 [340399]
    Other proteins in same PDB: d6bb9a2
    automated match to d1i2ka_
    complexed with cl, edo, mes, so4

Details for d6bb9a1

PDB Entry: 6bb9 (more details), 2.28 Å

PDB Description: the crystal structure of 4-amino-4-deoxychorismate lyase from salmonella typhimurium lt2
PDB Compounds: (A:) 4-amino-4-deoxychorismate lyase

SCOPe Domain Sequences for d6bb9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bb9a1 e.17.1.1 (A:1-269) automated matches {Salmonella typhimurium [TaxId: 90371]}
mflinghaqdqlavsdratqfgdgsfttarivdgnichleahlqrlqvaceklriafshw
stlrqemtmlatghdsgvlkviisrgsggrgysamncqaatrilsvsaypayysqwrkqg
itltlspiplgrnpylaglkhlnrleqvlirshleqtdadealvldsegwvteccaanlf
wrtgdivftprldqagvngimrqfclrqlaqspfqvlevqareeavrqadeiiicnalmp
iipirayhgtsyssrtlfqflapfcehpn

SCOPe Domain Coordinates for d6bb9a1:

Click to download the PDB-style file with coordinates for d6bb9a1.
(The format of our PDB-style files is described here.)

Timeline for d6bb9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6bb9a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6bb9b_