Lineage for d5xckb_ (5xck B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2231921Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2231922Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2232278Family d.159.1.0: automated matches [191347] (1 protein)
    not a true family
  6. 2232279Protein automated matches [190255] (5 species)
    not a true protein
  7. 2232285Species Entamoeba histolytica [TaxId:5759] [339925] (4 PDB entries)
  8. 2232291Domain d5xckb_: 5xck B: [340343]
    automated match to d1z2wa1
    mutant

Details for d5xckb_

PDB Entry: 5xck (more details), 2.2 Å

PDB Description: crystal structure of vps29 double mutant (d62a/h86a) from entamoeba histolytica
PDB Compounds: (B:) Vacuolar protein sorting-associated protein 29

SCOPe Domain Sequences for d5xckb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xckb_ d.159.1.0 (B:) automated matches {Entamoeba histolytica [TaxId: 5759]}
mlvlvigdfhvphrsaaipqvfldrlntgriqtvlctgnlcgketydilrtlarevhvvk
gafdemqglnetevikignfkiglmaghqvipwgdrealaiyqrqldvdilitghthkle
tkevggkyflnpgsatgaysplvdnpvpsfmlleindseltiyeytlvdgsvkcervdfn

SCOPe Domain Coordinates for d5xckb_:

Click to download the PDB-style file with coordinates for d5xckb_.
(The format of our PDB-style files is described here.)

Timeline for d5xckb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5xcka_