SCOPe 2.06: Domain d1qk3b1: 1qk3 B:1-228

Lineage for d1qk3b1 (1qk3 B:1-228)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)

7. Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)

8. Domain d1qk3b1: 1qk3 B:1-228 [34032]
   Other proteins in same PDB: d1qk3b2, d1qk3c2
   complexed with 5gp

Details for d1qk3b1

PDB Entry: 1qk3, 1.65 Å

PDB Description: toxoplasma gondii hypoxanthine-guanine phosphoribosyltransferase gmp complex

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1qk3b1:

Sequence; same for both SEQRES and ATOM records:

>d1qk3b1 c.61.1.1 (B:1-228) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkf

Timeline for d1qk3b1:

• d1qk3b1 first appeared (with stable ids) in SCOP 1.55, called d1qk3b_
  
• d1qk3b1 was called d1qk3b_ in SCOPe 2.05
  
• d1qk3b1 appears in SCOPe 2.07
  
• d1qk3b1 appears in the current release, SCOPe 2.08