SCOPe 2.08: Domain d1fsga1: 1fsg A:1-230

Lineage for d1fsga1 (1fsg A:1-230)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species)

7. Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries)

8. Domain d1fsga1: 1fsg A:1-230 [34029]
   Other proteins in same PDB: d1fsga2, d1fsgc2
   complexed with 9dg, mg, prp

Details for d1fsga1

PDB Entry: 1fsg, 1.05 Å

PDB Description: toxoplasma gondii hypoxanthine-guanine phosphoribosyltransferase complexed with 9-deazaguanine, alpha-d-5-phosphoribosyl-1- pyrophosphate (prpp) and two mg2+ ions

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d1fsga1:

Sequence; same for both SEQRES and ATOM records:

>d1fsga1 c.61.1.1 (A:1-230) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]}
maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek

Timeline for d1fsga1:

• d1fsga1 first appeared (with stable ids) in SCOP 1.55, called d1fsga_
  
• d1fsga1 appears in SCOPe 2.07