![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Hypoxanthine-guanine-xanthine PRTase [53275] (3 species) |
![]() | Species Toxoplasma gondii [TaxId:5811] [53277] (5 PDB entries) |
![]() | Domain d1fsgc1: 1fsg C:1-230 [34030] Other proteins in same PDB: d1fsga2, d1fsgc2 complexed with 9dg, mg, prp |
PDB Entry: 1fsg (more details), 1.05 Å
SCOPe Domain Sequences for d1fsgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsgc1 c.61.1.1 (C:1-230) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfek
Timeline for d1fsgc1: