Lineage for d5h4vb2 (5h4v B:299-466)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334245Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2334246Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) (S)
  5. 2334273Family a.97.1.0: automated matches [227179] (1 protein)
    not a true family
  6. 2334274Protein automated matches [226898] (7 species)
    not a true protein
  7. 2334291Species Xanthomonas oryzae [TaxId:291331] [339993] (1 PDB entry)
  8. 2334293Domain d5h4vb2: 5h4v B:299-466 [340250]
    Other proteins in same PDB: d5h4va1, d5h4vb1, d5h4vc1, d5h4vd1, d5h4ve1, d5h4vf1
    automated match to d4g6za2

Details for d5h4vb2

PDB Entry: 5h4v (more details), 3 Å

PDB Description: structure of glutamyl-trna synthetase (xoo1504) from xanthomonas oryzae pv. oryzae
PDB Compounds: (B:) Glutamate--tRNA ligase

SCOPe Domain Sequences for d5h4vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h4vb2 a.97.1.0 (B:299-466) automated matches {Xanthomonas oryzae [TaxId: 291331]}
dmaklgwvnqhylktddpasiapqleyqlaklgvdlaagpaaadvvvalrervhtlkema
ekavvwyqpletydaaavmkhlklgaevplgkarellaavdqwsvdsvsaalhdaaaale
lgmgkvaqplrvaitgtqvspdisqtvylagregalkridaaltkiga

SCOPe Domain Coordinates for d5h4vb2:

Click to download the PDB-style file with coordinates for d5h4vb2.
(The format of our PDB-style files is described here.)

Timeline for d5h4vb2: