SCOPe 2.07: Domain d5nreb_: 5nre B:

Lineage for d5nreb_ (5nre B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
   automatically mapped to Pfam PF03414

6. Protein alpha-1,3-galactosyltransferase catalytic domain [64132] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64133] (28 PDB entries)
   Uniprot P14769

8. Domain d5nreb_: 5nre B: [340039]
   automated match to d2vs4a_
   complexed with lat

Details for d5nreb_

PDB Entry: 5nre, 1.98 Å

PDB Description: a native ternary complex of alpha-1,3-galactosyltransferase (a3galt) supports a conserved reaction mechanism for retaining glycosyltransferases - a3galt in complex with lactose - a3galt-lat

PDB Compounds: (B:) n-acetyllactosaminide alpha-1,3-galactosyltransferase

SCOPe Domain Sequences for d5nreb_:

Sequence; same for both SEQRES and ATOM records:

>d5nreb_ c.68.1.9 (B:) alpha-1,3-galactosyltransferase catalytic domain {Cow (Bos taurus) [TaxId: 9913]}
klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhdeshln
kyfllnkptkilspeycwdyhiglpadiklvkmswq

Timeline for d5nreb_:

• d5nreb_ first appeared in SCOPe 2.06
  
• d5nreb_ appears in the current release, SCOPe 2.08