SCOPe 2.08: Domain d1bifa2: 1bif A:250-468

Lineage for d1bifa2 (1bif A:250-468)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.4: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53267] (1 protein)

6. Protein 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain [53268] (2 species)
   bifunctional enzyme

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [53269] (8 PDB entries)

8. Domain d1bifa2: 1bif A:250-468 [34003]
   Other proteins in same PDB: d1bifa1
   complexed with ags, gol, mg, po4

Details for d1bifa2

PDB Entry: 1bif, 2 Å

PDB Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate

PDB Compounds: (A:) 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase

SCOPe Domain Sequences for d1bifa2:

Sequence; same for both SEQRES and ATOM records:

>d1bifa2 c.60.1.4 (A:250-468) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, phosphatase domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
siylcrhgeselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvftsqmkrtiqt
aealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryrypkgesyedlv
qrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtvlkltpvaygc
kvesiflnvaavnthrdrpqnvdisrpseealvtvpahq

Timeline for d1bifa2:

• d1bifa2 first appeared (with stable ids) in SCOP 1.55, called d1bif_2
  
• d1bifa2 appears in SCOPe 2.07