PDB entry 1bif

View 1bif on RCSB PDB site
Description: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with ATP-g-s and phosphate
Class: bifunctional enzyme
Keywords: kinase, transferase (phospho), phosphatase, hydrolase (phospho), glycolysis, bifunctional enzyme
Deposited on 1996-11-08, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphofructo-2-kinase/ fructose-2,6-bisphosphatase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: RT2K
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bifa1, d1bifa2
  • Heterogens: MG, PO4, AGS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bifA (A:)
    maspreltqnplkkifmpysngrpalhasqrgvcmtncptlivmvglpargktyiskklt
    rylnfigvptrefnvgqyrrdmvktyksfefflpdneeglkirkqcalaalndvrkflse
    egghvavfdatnttrerramifnfgeqngyktffvesicvdpeviaanivqvklgspdyv
    nrdsdeatedfmrriecyensyesldeeqdrdlsyikimdvgqsyvvnrvadhiqsrivy
    ylmnihvtprsiylcrhgeselnlkgriggdpglsprgrefskhlaqfisdqnikdlkvf
    tsqmkrtiqtaealsvpyeqfkvlneidagvceemtyeeiqdhyplefalrdqdkyryry
    pkgesyedlvqrlepvimelerqenvlvichqavmrcllayfldkaaeelpylkcplhtv
    lkltpvaygckvesiflnvaavnthrdrpqnvdisrpseealvtvpahq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bifA (A:)
    cptlivmvglpargktyiskkltrylnfigvptrefnvgqyrrdmvktyksfefflpdne
    eglkirkqcalaalndvrkflseegghvavfdatnttrerramifnfgeqngyktffves
    icvdpeviaanivqvklgspdyvnrdsdeatedfmrriecyensyesldeeqdrdlsyik
    imdvgqsyvvnrvadhiqsrivyylmnihvtprsiylcrhgeselnlkgriggdpglspr
    grefskhlaqfisdqnikdlkvftsqmkrtiqtaealsvpyeqfkvlneidagvceemty
    eeiqdhyplefalrdqdkyryrypkgesyedlvqrlepvimelerqenvlvichqavmrc
    llayfldkaaeelpylkcplhtvlkltpvaygckvesiflnvaavnthrdrpqnvdisrp
    seealvtvpahq