Lineage for d1qfxb_ (1qfx B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127984Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2127985Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2128137Family c.60.1.2: Histidine acid phosphatase [53258] (4 protein domains)
  6. 2128142Protein Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) [53263] (4 species)
  7. 2128151Species Aspergillus niger [TaxId:5061] [53265] (3 PDB entries)
  8. 2128153Domain d1qfxb_: 1qfx B: [33995]
    complexed with gol, nag, so4

Details for d1qfxb_

PDB Entry: 1qfx (more details), 2.4 Å

PDB Description: ph 2.5 acid phosphatase from aspergillus niger
PDB Compounds: (B:) protein (ph 2.5 acid phosphatase)

SCOPe Domain Sequences for d1qfxb_:

Sequence, based on SEQRES records: (download)

>d1qfxb_ c.60.1.2 (B:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]}
kqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimvkrhgerypspsag
kdieealakvysintteykgdlaflndwtyyvpnecyynaettsgpyaglldaynhgndy
karyghlwngetvvpffssgygrvietarkfgegffgynystnaalniisesevmgadsl
tptcdtdndqttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynlmvmasfelnarpf
snwinaftqdewvsfgyvedlnyyycagpgdknmaavgavyanasltllnqgpkeagslf
fnfahdtnitpilaalgvlipnedlpldrvafgnpysignivpmgghltierlscqatal
sdegtyvrlvlneavlpfndctsgpgyscplanytsilnknlpdytttcnvsasypqyls
fwwnyntttelnyrsspiacqegdamd

Sequence, based on observed residues (ATOM records): (download)

>d1qfxb_ c.60.1.2 (B:) Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase) {Aspergillus niger [TaxId: 5061]}
kqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimvkrhgerypspsag
kdieealakvysiteykgdlaflndwtyyvpnecyynaettsgpyaglldaynhgndyka
ryghlwngetvvpffssgygrvietarkfgegffgynystnaalniisesevmgadsltp
tcdtdnttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynlmvmasfelnarpfsnwi
naftqdewvsfgyvedlnyyycagpgdknmaavgavyanasltllnqgpkeagslffnfa
hdtnitpilaalgvlipnedlpldrvafgnpysignivpmgghltierlscqatalsdeg
tyvrlvlneavlpfndctsgpgyscplanytsilnknlpdytttcnvsasypqylsfwwn
yntttelnyrsspiacqegdamd

SCOPe Domain Coordinates for d1qfxb_:

Click to download the PDB-style file with coordinates for d1qfxb_.
(The format of our PDB-style files is described here.)

Timeline for d1qfxb_: