PDB entry 1qfx

View 1qfx on RCSB PDB site
Description: ph 2.5 acid phosphatase from aspergillus niger
Class: hydrolase
Keywords: phosphomonoesterase, hydrolase
Deposited on 1999-04-15, released 2000-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.183
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ph 2.5 acid phosphatase)
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qfxa_
  • Chain 'B':
    Compound: protein (ph 2.5 acid phosphatase)
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1qfxb_
  • Heterogens: NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qfxA (A:)
    fsygaaipqstqekqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimv
    krhgerypspsagkdieealakvysintteykgdlaflndwtyyvpnecyynaettsgpy
    aglldaynhgndykaryghlwngetvvpffssgygrvietarkfgegffgynystnaaln
    iisesevmgadsltptcdtdndqttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynl
    mvmasfelnarpfsnwinaftqdewvsfgyvedlnyyycagpgdknmaavgavyanaslt
    llnqgpkeagslffnfahdtnitpilaalgvlipnedlpldrvafgnpysignivpmggh
    ltierlscqatalsdegtyvrlvlneavlpfndctsgpgyscplanytsilnknlpdytt
    tcnvsasypqylsfwwnyntttelnyrsspiacqegdamd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfxA (A:)
    kqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimvkrhgerypspsag
    kdieealakvysiteykgdlaflndwtyyvpnecyynaettsgpyaglldaynhgndyka
    ryghlwngetvvpffssgygrvietarkfgegffgynystnaalniisesevmgadsltp
    tcdtttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynlmvmasfelnarpfsnwina
    ftqdewvsfgyvedlnyyycagpgdknmaavgavyanasltllnqgpkeagslffnfahd
    tnitpilaalgvlipnedlpldrvafgnpysignivpmgghltierlscqatalsdegty
    vrlvlneavlpfndctsgpgyscplanytsilnknlpdytttcnvsasypqylsfwwnyn
    tttelnyrsspiacqegdamd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qfxB (B:)
    fsygaaipqstqekqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimv
    krhgerypspsagkdieealakvysintteykgdlaflndwtyyvpnecyynaettsgpy
    aglldaynhgndykaryghlwngetvvpffssgygrvietarkfgegffgynystnaaln
    iisesevmgadsltptcdtdndqttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynl
    mvmasfelnarpfsnwinaftqdewvsfgyvedlnyyycagpgdknmaavgavyanaslt
    llnqgpkeagslffnfahdtnitpilaalgvlipnedlpldrvafgnpysignivpmggh
    ltierlscqatalsdegtyvrlvlneavlpfndctsgpgyscplanytsilnknlpdytt
    tcnvsasypqylsfwwnyntttelnyrsspiacqegdamd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qfxB (B:)
    kqfsqefrdgysilkhyggngpyservsygiardpptscevdqvimvkrhgerypspsag
    kdieealakvysiteykgdlaflndwtyyvpnecyynaettsgpyaglldaynhgndyka
    ryghlwngetvvpffssgygrvietarkfgegffgynystnaalniisesevmgadsltp
    tcdtdnttcdnltyqlpqfkvaaarlnsqnpgmnltasdvynlmvmasfelnarpfsnwi
    naftqdewvsfgyvedlnyyycagpgdknmaavgavyanasltllnqgpkeagslffnfa
    hdtnitpilaalgvlipnedlpldrvafgnpysignivpmgghltierlscqatalsdeg
    tyvrlvlneavlpfndctsgpgyscplanytsilnknlpdytttcnvsasypqylsfwwn
    yntttelnyrsspiacqegdamd