Lineage for d5ojja_ (5ojj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2939466Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 2939467Protein automated matches [190120] (9 species)
    not a true protein
  7. 2939474Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries)
  8. 2939480Domain d5ojja_: 5ojj A: [339859]
    automated match to d1qcqa_
    complexed with act, trs, zn

Details for d5ojja_

PDB Entry: 5ojj (more details), 1.85 Å

PDB Description: crystal structure of the zn-bound ubiquitin-conjugating enzyme ube2t
PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 t

SCOPe Domain Sequences for d5ojja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ojja_ d.20.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asrlkrelhmlatepppgitcwqdkdqmddlraqilggantpyekgvfkleviiperypf
eppqirfltpiyhpnidsagricldvlklppkgawrpslniatvltsiqllmsepnpddp
lmadissefkynkpaflknarqwtekharqk

SCOPe Domain Coordinates for d5ojja_:

Click to download the PDB-style file with coordinates for d5ojja_.
(The format of our PDB-style files is described here.)

Timeline for d5ojja_: