Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Hemopoetic cell kinase Hck [55565] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55566] (23 PDB entries) |
Domain d5h0ga2: 5h0g A:147-249 [339774] Other proteins in same PDB: d5h0ga1, d5h0ga3, d5h0ga4 automated match to d1qcfa2 complexed with oou |
PDB Entry: 5h0g (more details), 1.8 Å
SCOPe Domain Sequences for d5h0ga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h0ga2 d.93.1.1 (A:147-249) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} eewffkgisrkdaerqllapgnmlgsfmirdsettkgsyslsvrdydprqgdtvkhykir tldnggfyisprstfstlqelvdhykkgndglcqklsvpcmss
Timeline for d5h0ga2: