Lineage for d1bq4b_ (1bq4 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863193Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1863194Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1863195Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1863205Protein Phosphoglycerate mutase [53256] (6 species)
  7. 1863206Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)
  8. 1863222Domain d1bq4b_: 1bq4 B: [33975]
    complexed with bhc, so4

Details for d1bq4b_

PDB Entry: 1bq4 (more details), 2.5 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate
PDB Compounds: (B:) protein (phosphoglycerate mutase 1)

SCOPe Domain Sequences for d1bq4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq4b_ c.60.1.1 (B:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaaa

SCOPe Domain Coordinates for d1bq4b_:

Click to download the PDB-style file with coordinates for d1bq4b_.
(The format of our PDB-style files is described here.)

Timeline for d1bq4b_: