SCOPe 2.05: Domain d1bq4a_: 1bq4 A:

Lineage for d1bq4a_ (1bq4 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein Phosphoglycerate mutase [53256] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53257] (6 PDB entries)

8. Domain d1bq4a_: 1bq4 A: [33974]
   complexed with bhc, so4

Details for d1bq4a_

PDB Entry: 1bq4, 2.5 Å

PDB Description: saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate

PDB Compounds: (A:) protein (phosphoglycerate mutase 1)

SCOPe Domain Sequences for d1bq4a_:

Sequence; same for both SEQRES and ATOM records:

>d1bq4a_ c.60.1.1 (A:) Phosphoglycerate mutase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pklvlvrhgqsewneknlftgwvdvklsakgqqeaaragellkekkvypdvlytsklsra
iqtanialekadrlwipvnrswrlnerhygdlqgkdkaetlkkfgeekfntyrrsfdvpp
ppidasspfsqkgderykyvdpnvlpeteslalvidrllpywqdviakdllsgktvmiaa
hgnslrglvkhlegisdadiaklniptgiplvfeldenlkpskpsyyldpeaaa

Timeline for d1bq4a_:

• d1bq4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1bq4a_ appears in SCOPe 2.04
  
• d1bq4a_ appears in SCOPe 2.06
  
• d1bq4a_ appears in the current release, SCOPe 2.08