Lineage for d5nb4s_ (5nb4 S:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2302308Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2302507Protein automated matches [190531] (20 species)
    not a true protein
  7. 2302600Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)
  8. 2302619Domain d5nb4s_: 5nb4 S: [339568]
    automated match to d3v57b_
    complexed with mpd, mrd, na, no3, peb, pi

Details for d5nb4s_

PDB Entry: 5nb4 (more details), 1.14 Å

PDB Description: atomic resolution structure of c-phycoerythrin from marine cyanobacterium phormidium sp. a09dm at ph 7.5
PDB Compounds: (S:) Phycoerythrin Beta subunit,Phycoerythrin Beta subunit

SCOPe Domain Sequences for d5nb4s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nb4s_ a.1.1.3 (S:) automated matches {Phormidium rubidum [TaxId: 865859]}
mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
sals

SCOPe Domain Coordinates for d5nb4s_:

Click to download the PDB-style file with coordinates for d5nb4s_.
(The format of our PDB-style files is described here.)

Timeline for d5nb4s_: