SCOPe 2.07: Domain d5nb3g_: 5nb3 G:

Lineage for d5nb3g_ (5nb3 G:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (20 species)
   not a true protein

7. Species Phormidium rubidum [TaxId:865859] [272704] (5 PDB entries)

8. Domain d5nb3g_: 5nb3 G: [339559]
   automated match to d1eyxa_
   complexed with cl, fmt, mpd, mrd, na, peb

Details for d5nb3g_

PDB Entry: 5nb3, 1.38 Å

PDB Description: high resolution c-phycoerythrin from marine cyanobacterium phormidium sp. a09dm at ph 7.5

PDB Compounds: (G:) Phycoerythrin Alpha subunit,Phycoerythrin Alpha subunit,Phycoerythrin Alpha subunit

SCOPe Domain Sequences for d5nb3g_:

Sequence; same for both SEQRES and ATOM records:

>d5nb3g_ a.1.1.3 (G:) automated matches {Phormidium rubidum [TaxId: 865859]}
mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
glptapyvealsfarnrgcaprdmsaqalteynalldyainsls

Timeline for d5nb3g_:

• d5nb3g_ first appeared in SCOPe 2.06
  
• d5nb3g_ appears in the current release, SCOPe 2.08