SCOP 1.71: Domain d2uaga2: 2uag A:298-437

Lineage for d2uaga2 (2uag A:298-437)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest

4. Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (2 families)

5. Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins)

6. Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species)

7. Species Escherichia coli [TaxId:562] [53247] (6 PDB entries)

8. Domain d2uaga2: 2uag A:298-437 [33951]
   Other proteins in same PDB: d2uaga1, d2uaga3
   complexed with adp, mg, uma

Details for d2uaga2

PDB Entry: 2uag, 1.7 Å

PDB Description: udp-n-acetylmuramoyl-l-alanine:d-glutamate ligase

SCOP Domain Sequences for d2uaga2:

Sequence; same for both SEQRES and ATOM records:

>d2uaga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

Timeline for d2uaga2:

• d2uaga2 first appeared (with stable ids) in SCOP 1.55
  
• d2uaga2 appears in SCOP 1.69
  
• d2uaga2 appears in SCOP 1.73
  
• d2uaga2 appears in the current release, SCOPe 2.08