![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
![]() | Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
![]() | Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
![]() | Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [53246] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [53247] (7 PDB entries) |
![]() | Domain d2uaga2: 2uag A:298-437 [33951] Other proteins in same PDB: d2uaga1, d2uaga3 complexed with adp, mg, uma |
PDB Entry: 2uag (more details), 1.7 Å
SCOPe Domain Sequences for d2uaga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2uaga2 c.59.1.1 (A:298-437) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld qfknfeqrgnefarlakelg
Timeline for d2uaga2: